PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013618694.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 238aa    MW: 27521 Da    PI: 8.5868
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013618694.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.3e-171057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed llv+ v+++G ++W+ +a+  g++Rt+k+c++rw +yl
   XP_013618694.1 10 KGPWTEQEDILLVNFVHMFGDRRWDFVAKVSGLNRTGKSCRLRWVNYL 57
                     79********************************************97 PP

2Myb_DNA-binding58.41.6e-1863108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+ l +++++++G++ W++Iar+++ gRt++++k++w++++
   XP_013618694.1  63 RGKMTPEEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 108
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.744157IPR017930Myb domain
SuperFamilySSF466891.65E-308104IPR009057Homeodomain-like
SMARTSM007171.8E-15959IPR001005SANT/Myb domain
PfamPF002491.2E-161057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-211164IPR009057Homeodomain-like
CDDcd001676.14E-111257No hitNo description
PROSITE profilePS5129427.67558112IPR017930Myb domain
SMARTSM007176.5E-1862110IPR001005SANT/Myb domain
PfamPF002497.3E-1763107IPR001005SANT/Myb domain
CDDcd001674.53E-1365108No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2465110IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MKNVQAEYRK GPWTEQEDIL LVNFVHMFGD RRWDFVAKVS GLNRTGKSCR LRWVNYLHPG  60
LKRGKMTPEE ERLVLELHAK WGNRWSKIAR KLPGRTDNEI KNYWRTHMRK IAQEKKRPMS  120
PTSSSSNFCS SSMTTATTQD TGGSKGKMNQ ECEDGYYSMD DIWREIDQSG ESITKPVKGM  180
YYSEQSCYLN FPPLASPAWE SSLESIWNMD ADESKMSSFA IDQFPLSFEH GSSWSSLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-2871101103MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196410.0AY519641.1 Arabidopsis thaliana MYB transcription factor (At5g59780) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013618694.11e-180PREDICTED: transcription factor MYB59 isoform X3
RefseqXP_013738383.11e-179PREDICTED: transcription factor MYB59-like isoform X1
SwissprotQ4JL841e-154MYB59_ARATH; Transcription factor MYB59
TrEMBLA0A0D3AKW51e-180A0A0D3AKW5_BRAOL; Uncharacterized protein
STRINGBra020289.1-P1e-161(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.31e-151myb domain protein 59